PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G158600.2.p
Common NameSb01g013830, SORBIDRAFT_01g013830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 337aa    MW: 35875.2 Da    PI: 6.8483
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G158600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.15.6e-102331648
                          HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          v ++G + W+ Ia+ ++ gR +kqc++rw ++l
  Sobic.001G158600.2.p  2 VMKHGDRKWAVIAQSLP-GRVGKQCRERWTNHL 33
                          89***************.************996 PP

2Myb_DNA-binding49.97.4e-164281445
                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                          WT+e+d  l++a+k+ G++ W+tIa  ++ gR+++ +k++w+
  Sobic.001G158600.2.p 42 WTEEDDMALIKAHKRCGNH-WSTIATFLP-GRSENAVKNHWN 81
                          *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001671.25E-8133No hitNo description
SMARTSM007171.7135IPR001005SANT/Myb domain
PROSITE profilePS5129414.203133IPR017930Myb domain
PfamPF002497.4E-9233IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-18240IPR009057Homeodomain-like
SuperFamilySSF466895.62E-271288IPR009057Homeodomain-like
PROSITE profilePS5129423.4573488IPR017930Myb domain
SMARTSM007172.9E-153886IPR001005SANT/Myb domain
PfamPF002496.2E-144181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-204185IPR009057Homeodomain-like
CDDcd001677.72E-134284No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVMKHGDRKW AVIAQSLPGR VGKQCRERWT NHLRPDLKKT LWTEEDDMAL IKAHKRCGNH  60
WSTIATFLPG RSENAVKNHW NATKRSLKAK RRLKKKNNAQ QVPPGQWSVL EEYIRSVYPD  120
LADGAAPTPP PEEDSSPPSS YNNLGSYSYG GEVISSPQSS AAAAAAAAAA VAAAAAPPGA  180
AFDQLTAMGL YLGASSSSAP PSANLGAMNM NSDAVAPFLQ LDLNTYYGAP TMQLMPPMGP  240
HMMEHDHHHQ QAAASYAAAA AANLITYPFV DNMMWQSPFA VHHTSAAYGG GDASGAGPSN  300
AAGAAVPDDV DVVQMASREF LTPSEDEVTL DLARFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-3618518102MYB PROTO-ONCOGENE PROTEIN
1msf_C2e-3618518102C-Myb DNA-Binding Domain
1mse_C2e-3618518102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0359591e-162BT035959.1 Zea mays full-length cDNA clone ZM_BFb0089N08 mRNA, complete cds.
GenBankJX4699081e-162JX469908.1 Zea mays subsp. mays clone UT3152 MYB-type transcription factor mRNA, partial cds.
GenBankJX4699091e-162JX469909.1 Zea mays subsp. mays clone UT3153 MYB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464189.10.0hypothetical protein SORBIDRAFT_01g013830
TrEMBLC5WR980.0C5WR98_SORBI; Putative uncharacterized protein Sb01g013830
STRINGSb01g013830.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.17e-37myb domain protein 64